The correct answer is high, low.
Arteries are part of the circulatory system and are responsible for carrying blood away from the heart and around the body. The arterial blood is oxygenated and this process ensures that every tissue around the body will receive oxygen and nutrients through this blood flow.
Veins are also part of the circulatory system and are responsible for carrying the deoxygenated blood from the tissues back to the heart.
Venous pressure is much lower than the arterial pressure. More specifically, venous pressure ranges from 5 to 8 mmHg, while arterial pressure ranges from 15 to 30 mmHg.
<span>the virus injects the genetic info. this can be RNA or DNA. retroviruses inject RNA. after injection, the host cell transcription/translation machinery is hijacked and starts making virus proteins from the viral genes.</span>
The answer is 23 chromosomes.
No, what determines a dominant gene is how many copies of that gene exists within the parent. This doesn't mean it will be the most common because of recessive genes. It doesn't matter how many copies a dominant gene has, a recessive gene can still appear in the offspring.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
