I pretty sure that it include both biotic and abiotic. But "C" is wrong. Now your answers are between "A,B and C"
Hello
your answer to this response is
Industrial waste. Industrial waste is the waste produced by industrial activity which includes any material that is rendered useless during a manufacturing process such as that of factories, industries, mills, and mining operations. It has existed since the start of the Industrial Revolution.
I hope this helsp you out
have a great morning
FaithRawlins14
Answer:
Lunar Eclipse: The moon moves in an orbit around Earth, and at the same time, Earth orbits the sun. Sometimes Earth moves between the sun and the moon. When this happens, Earth blocks the sunlight that normally is reflected by the moon. (This sunlight is what causes the moon to shine.)
Explanation:
The answer is density-dependent factor
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
