Answer:
A does dissolve in a greater degree as the temperature increases. B does not dissolve up to 80 degrees.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Explanation:
1- closely packed osteons or haversian systems, used to provide strength and protection to bones.
2- Spongy bone consists of plates (trabeculae) and bars of bone adjacent to small, irregular cavities that contain red bone marrow. provides balance to the dense and heavy compact bone by making bones lighter so that muscles can move them more easily.
Answer: Hypoxia
Explanation: hypoxia induces the production of erythropoietin, which is a hormome produced by the kidneys to help increase the productiom of red blood cells in the body. In Jessica's case, she might be experiencing this due to a change in ultitide whereby her body needs more oxygen than it originally gets (crllular hypoxis), therefore, her body signals for more red blood cell production. The erythropoietin will then be secreted and more red blood cells will be formed by the bone marrow through the hormonal action.
A. Transport? i could be wrong
