Answer:
Its diabetes i just took it. its right.
Explanation:
Please rate me brainliest!
The physical characteristics of an organism is its phenotype. I remember this because phenotype and physical both start with 'ph.'
Hope this helps. Good luck! :)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
They contain protein fibres that can contract when energy is available, making the cells shorter.
Answer:
How do nutrients move through an environment? What drives the movement of nutrients?
My answer 6b: Nutrients are often transported across the environment by migrating from the physical environment into living creatures and then being recycled back into the physical environment. For example, an animal could receive nutrition by eating plants. To stay alive, the animal uses the chemical energy gained from the food. When the animal dies, the nutrients in its body return to the soil and are re-absorbed by plants. The transport of nutrients in the ecosystem is driven by nutrient cycles.