I believe this is the answer you are looking for:
<span>C. The size and shape of their beaks</span>
Answer:how can chemosynthetic organisms help scientists to understand how life developed on earth? for example, temperature, a species may evolve to a temperature change over time. it could alter the food sources available, and then that species would eat that food source and adapt to the energy given off by that source.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: Alexandrium catenella is a species of dinoflagellates. Alexandrium has two flagella that enable it to swim. While one flagellum encircles the cell causing the cell to rotate and move forward, the other extends behind the cell and controls the direction.
The cell wall is composed of cellulose Theca.
Length 20 - 48 μm, width 18 - 34 μm
Yellow-green to orange-brown
Forms chains of 2, 4 or 8 cells
Can I see the picture that you are talking about please
