1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
melomori [17]
3 years ago
8

14c^3d^2-21c^2d^3/14cd

Mathematics
1 answer:
levacccp [35]3 years ago
3 0

14c³d²-21c²d³/14cd

= (196c^4d³-21c²d³)/ 14cd

= (196c³d²-21cd²)/14

= (28c³d²-3cd²)/2


I hope that's help !

You might be interested in
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
Which of the following recursive formulas represents the same arithmetic sequence as the explicit formula an=5+(n-1)2?
satela [25.4K]

Answer:

A

Step-by-step explanation:

In Arithmetic sequence , 2nd term = first term + d

3rd term = 2nd term + d

In this given explicit formula, we  can find that d =2

an ----> n th term;   an-1 -----> n-1 th term

an = an-1 th term + 2

7 0
3 years ago
Read 2 more answers
If you roll a number cube 12 times, about how many times would you expect to roll a 5 or 6
Marrrta [24]
You have a 1/3 chance each time you role So 1/3 x 12 = 4 times that you would role a 5 or a 6
6 0
3 years ago
Can someone help me please? Am I right or no?
Juliette [100K]
The figure consists of three objects, a rectangle, a trapezoid, a triangle

Find the area of the rectangle
The rectangle is 16 in long and 9 in wide
a₁ = l × w
a₁ = 16 × 9
a₁ = 144 in²

Find the area of the trapezoid
The base of trapezoid is 31 in and 16 in, and the height is 35 - 20 = 15 in.
a₂ = 1/2 × (a + b) × h
a₂ = 1/2 × (31 + 16) × 15
a₂ = 1/2 × 47 × 15
a₂ = 352.5 in²

Find the area of the triangle
The base of the triangle is 31 in, the height is 20 in
a₃ = 1/2 × b × h
a₃ = 1/2 × 31 × 20
a₃ = 310 in²

Add the area together
a = a₁ + a₂ + a₃
a = 144 + 352.5 + 310
a = 806.5

The answer is 806.5 in²
4 0
3 years ago
What is the sum of 6 consecutive numbers that equal 393
ehidna [41]
65.5

hope it is correct
8 0
4 years ago
Other questions:
  • What is the solution of the equation (4x + 3)2 = 18?
    6·2 answers
  • If Amelia would like to double her money in twelve years, how much interest does she need to earn? 6 percent 12 percent 10 perce
    6·1 answer
  • please help me answer this question Solve: y − x = 12 y + x = -26 (19, -7). (-7, 1). (7, 19). (-19, -7).
    9·1 answer
  • The area of a rectangle is 77 yd2, and the length of the rectangle is 3 yd more than twice the width find the dimensions of the
    12·1 answer
  • At your school, the building is 20 feet tall, a tree's height is 252 inches, and the flagpole is 6 yards high. Which of the thre
    9·1 answer
  • What is the nth derivative of sin^3x?
    8·1 answer
  • 4. A function consists of the pairs (2,3), (x, y) and (5,6). If the inverse is also a function what values can y NOT be? Explain
    7·1 answer
  • Nick, Sarah and Gavyn share some sweets in the ratio 2:3:3. Nick gets 28 sweets. How many did Gavyn get?
    8·1 answer
  • Write the ratio as a fraction in simplest form, with whole numbers in the numerator and denominator.
    7·1 answer
  • Which group of integers is in order from least to greatest?
    12·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!