1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Marysya12 [62]
4 years ago
10

Rounded 2.317 to the nearest thousand

Mathematics
1 answer:
damaskus [11]4 years ago
3 0

Answer:

2.32

Step by Step Explanation:

5 and above, Give it a shove

1 rounds to 2 because of the 7

2.317 = 2.32

You might be interested in
Find the image of the given point
hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0
3 years ago
What is the common denominator of 5/12 and 3/5
Harlamova29_29 [7]
The answer is 60 this is the last
6 0
4 years ago
What is the equation of the line that passes through the point (-4,-2)(−4,−2) and has a slope of -\frac{1}{2}− 2 1 ​ ?
harkovskaia [24]

Answer:

Question not clear. I cant see the value for slope.

Step-by-step explanation:

5 0
3 years ago
According to a​ report, 67.5​% of murders are committed with a firearm. ​(a) If 200 murders are randomly​ selected, how many wou
kolezko [41]

Answer: The answer is 135 murders.

Step-by-step explanation: The report tells us that statistically 67.5% of murders are committed using a firearm. It follows therefore that in a sample of 200 randomly selected murders, one would expect that 67.5% of those would be by a firearm. \frac{67.5}{100} * 200 = 135.

It would certainly be higher that the expected value based on previous data collected but it would not be unusual because one sample may have a higher than "normal" amount of murders by firearm. Statistics aren't going to be exact for every sample.

8 0
3 years ago
In the summer the temperature goes above 95 degrees on 56% of days. If the summer have 94 days how many should be above 95 degre
Otrada [13]
.56 x 94 = 52.64
You can't have .64 of a day so round up to 53 days
4 0
3 years ago
Read 2 more answers
Other questions:
  • the area of a square game board is 144 square inches what is the length of one of the sides of the board
    9·2 answers
  • What is the product? 6.4(-3.7) -23.68 23.68 11.84 -20.48
    6·1 answer
  • The sum of my two digits is 13. I am not devise a ball by two. List all possible numbers I could be
    15·2 answers
  • <img src="https://tex.z-dn.net/?f=11%20%2B%20k%20%3D%20%20-%202" id="TexFormula1" title="11 + k = - 2" alt="11 + k = - 2" alig
    9·1 answer
  • I need to check the quadratic equation 3z=-z^2 i got z=0 and z=-3 just need to know how to check it. Thanx
    8·1 answer
  • 4 ten and 17 hundredth in decimals UNSERIOUS ANSWERS REPORTED
    7·1 answer
  • I need help!!!!!!!!!!
    9·1 answer
  • Fast I need help do t understand !!!!!
    10·2 answers
  • Desperate<br> please Hurry<br> Question Down Below
    11·1 answer
  • Write an expression for the sequence of operations described below.
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!