1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Nina [5.8K]
3 years ago
13

Can someone tell me how to solve translations please?

Mathematics
1 answer:
Sophie [7]3 years ago
6 0

Step-by-step explanation:

Hey there!

Here; The coordinates are ; H(-4,-2), G(-5,3), F(-2,1)

The translation P(x,y) = P'(X+7,y)

Use same formula.

H(-4,-2) -------> P'(3,-2)

G(-5,3)-----------> G'(2,3)

F(-2,1)------------> F'(5,1)

<u>There</u><u>fore</u><u>,</u><u> </u><u>the</u><u> </u><u>answer</u><u> </u><u>is</u><u> </u><u>Option</u><u> </u><u>C</u><u>.</u>

<u>Hop</u><u>e</u><u> it</u><u> helps</u><u>.</u><u>.</u>

You might be interested in
If m∠2 = 41°, m∠5 = 94°, and m∠10 = 109°, find each measure.
Orlov [11]

Answer:

Step-by-step explanation:

It's given in this question,

m∠2 = 41°, m∠5 = 94° and m∠10 = 109°

Since, ∠2 ≅ ∠9 [Alternate interior angles]

m∠2 = m∠9 = 41°

m∠8 + m∠9 + m∠10 = 180° [Sum of angles at a point of a line]

m∠8 + 41 + 109 = 180

m∠8 = 180 - 150

m∠8 = 30°

Since, m∠2 + m∠7 + m∠8 = 180° [Sum of interior angles of a triangle]

41 + m∠7 + 30 = 180

m∠7 = 180 - 71

m∠7 = 109°

m∠6 + m∠7 = 180° [linear pair of angles]

m∠6 + 109 = 180

m∠6 = 180 - 109

        = 71°

Since m∠5 + m∠4 = 180° [linear pair of angles]

m∠4 + 94 = 180

m∠4 = 180 - 94

m∠4 = 86°

Since, m∠4 + m∠3 + m∠9 = 180° [Sum of interior angles of a triangle]

86 + m∠3 + 41 = 180

m∠3 = 180 - 127

m∠3 = 53°

m∠1 + m∠2 + m∠3 = 180° [Angles on a point of a line]

m∠1 + 41 + 53 = 180

m∠1 = 180 - 94

m∠1 = 86°

8 0
3 years ago
A fossil was analyzed and determined to have a carbon-14 level that is 80 % that of living organisms. the half-life of c-14 is 5
liq [111]

Answer:

The fossil is 1860 years old.

Step-by-step explanation:

The equation for the amount of fossil has the following format:

Q(t) = Q(0)e^{rt}

In which Q(t) is the amount after t years, Q(0) is the initial amount and r is the rate of change.

Half-life of c-14 is 5730 years.

This means that Q(5730) = 0.5Q(0)

So

Q(t) = Q(0)e^{rt}

0.5Q(0) = Q(0)e^{5730r}

e^{5730r} = 0.5

\ln{e^{5730r}} = \ln{0.5}

5730r = \ln{0.5}

r = \frac{\ln{0.5}}{5730}

r = -0.00012

So

Q(t) = Q(0)e^{-0.00012t}

How old is the fossil?

This is t for which

Q(t) = 0.8Q(0)

So

Q(t) = Q(0)e^{-0.00012t}

0.8Q(0) = Q(0)e^{-0.00012t}

e^{-0.00012t} = 0.8

\ln{e^{-0.00012t}} = \ln{0.8}

-0.00012t = \ln{0.8}

t = -\frac{\ln{0.8}}{-0.00012}

t = 1860

The fossil is 1860 years old.

4 0
3 years ago
LESSON 10: ROAD TRIP Your car can travel 21.2 miles on one gallon of gasoline. Gas costs $2.40 per gallon. 1. How much will it c
Contact [7]
The answer is 17. option C
5 0
2 years ago
Sam shot the basketball 15 times. 40% of his shots were made. How many shots did Sam make?
love history [14]

Answer:

6

Step-by-step explanation:

40% is equal to 40/100

He made 40% of 15 shots so you miltiply 15 by 40/100 which is equal to 6.

6 0
2 years ago
Read 2 more answers
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
2 years ago
Read 2 more answers
Other questions:
  • What is the solution ?
    6·2 answers
  • What does it equal??​
    7·1 answer
  • -2,-7,-12 ,.... is an arithmetic sequence Find the sum of its first 20 terms ?​
    8·1 answer
  • What’s the complement for 12 degrees
    6·1 answer
  • Which equations are Parallel to y=2x+1
    12·1 answer
  • What is 9 × 1/4 I do not know how to do it so can any one plz help me know how to do this Thank you
    13·2 answers
  • Which is 2/3 of 18?<br><br> a.27<br> b.12<br> c.8<br> d.6
    14·1 answer
  • Item 10<br> Convert 514% to a decimal.<br><br> Enter you answer in the box below.
    15·1 answer
  • Please answer the question correctly while showing detailed working. ​
    15·2 answers
  • Please help solve 11x+10&gt;=150
    10·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!