1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
ZanzabumX [31]
3 years ago
6

The cost of tuition at Johnson Community College is $190 per credit hour. Each student also has to pay $60 in fees. Write a line

ar equation model for this situation. Use C for the cost and x for the number of credit hours.
Mathematics
2 answers:
natita [175]3 years ago
7 0
<span>The cost of tuition at Johnson Community College is will be : </span>C = 190x + 60
mrs_skeptik [129]3 years ago
5 0
The answer is

C=f(x)=190x + 60, 

You might be interested in
Find the image of the given point
hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0
3 years ago
Find the missing length of the triangle. <br> 20 km <br> 21 km <br> WHAT IS “C” PLEASE HELP
Leno4ka [110]

Answer:

C=29

Step-by-step explanation:

a^2 + b^2 = c^2

21^2 + 20^2 = c^2

441 + 400 = c^2

841 = c^2

\sqrt(841) = \squrt(c^2)

29 = c

6 0
3 years ago
Read 2 more answers
Solve for x: 10x – 3 + x &lt; 30
Gala2k [10]

Answer:

The correct answer would be the last one; x < 3.

Step-by-step explanation:

Step 1: Simplify both sides of the inequality.

11x - 3 < 30

Step 2: Add 3 to both sides.

11x - 3 + 3 < 30 + 3

11x < 33

Step 3L Divide both sides by 11.

11x/11 < 33/11

Therefor, the correct answer would be the last one: x < 3

Hope this helps!

7 0
3 years ago
Read 2 more answers
Write a sequence with exactly 5 terms and follow the pattern rule:
Aloiza [94]

Answer:

The pattern. 1, 4, 9, 16, … has no common difference. An explicit pattern rule is a pattern rule that tells you how to get any term in the pattern without listing all the terms before it. For example, an explicit pattern rule for 5, 8, 11, 14, … uses the first term (5) and the common difference (3).

5 0
3 years ago
Which of the following equations have complex roots?
Svetllana [295]

Answer: B

Step-by-step explanation:

We can rearrange the equation to get x^2=-\frac{2}{3}, which clearly has complex roots.

7 0
2 years ago
Read 2 more answers
Other questions:
  • Which expression has the same value as9
    5·1 answer
  • Using your new formula from the previous question ,what is the side length of an equlalertal trangle that has a perimeter of 24.
    5·1 answer
  • When multiplying with decimals...
    7·1 answer
  • Help! what is the surface area of the prism? 128in^2, 768in^2, 384in^2, or 480in^2
    13·1 answer
  • Can someone please help me on this one?
    14·2 answers
  • 5p + 9/2 + 2p+5/3 when p=5
    12·2 answers
  • g Assuming the probability of a single sample testing positive is 0.15​, find the probability of a positive result for two sampl
    11·1 answer
  • Pleaseeeee help I'll give Brainliest urgent!!!!!!!!!!!!!!!
    10·2 answers
  • If 12% of the air leaks out of Brian's bicycle tire every day, what percent of the air will be left after 2 days? After a week?
    12·1 answer
  • Solve for x I need help on this question
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!