1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Gwar [14]
3 years ago
15

Initial inputs of energy, water, fertilizer, and pesticides on high-yield crop varieties may initially have dramatic results. At

some point however, even with adidtional inputs, the yields level off. This result best illustrates
Biology
1 answer:
Tanya [424]3 years ago
8 0

Answer:

Principle of diminishing returns

Explanation:

In this case, Initial inputs of energy, water, fertilizer, and pesticides on high-yield crop varieties would produced high crop yields. As time goes on further adidtion of these same inputs of production would give the same or a lower yields of crops. Therefore, obeying the Principle of diminishing returns.

You might be interested in
What information did you include in our<br> response?
Daniel [21]

Answer:

All of the statements are true.

The X chromosome is one of the two sex chromosomes of humans and some animals (the other sex chromosome is the Y chromosome). Men have a single X chromosome and women two X chromosomes.

Diseases whose gene is localized on the X chromosome are most often transmitted in the X-linked recessive mode; some are transmitted on the dominant mode related to the X.

In this mode of inheritance, the morbid allele behaves like a recessive trait.

Women heterozygotes are not affected but can transmit the disease; they are aid to be conductive of the disease.

The disese is only manifested in male subjects (XY) with only one copy of the gene (hemizygous subjects)

3 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
What are the levels of organization in a shark
nexus9112 [7]
Cell
Tissue
Organ 
Organ System
Organism

3 0
3 years ago
Temperature is a way to measure the ___________ energy of particles of matter.
Fed [463]

Answer:

Kinetic

Explanation:

The average kinetic energy of the particles in a material is measured by temperature. The overall kinetic energy of the particles in a material is measured by thermal energy. The higher the particle mobility, the higher the temperature and thermal energy of a material.

3 0
2 years ago
A scientist wants to study the interactions of different birds in the southern part of a desert. What should the scientist do fi
kati45 [8]

Answer;

C.Identify each bird species by using a dichotomous key.

Explanation;

-A dichotomous key is a tool that is used to determine the identity of items in an ecosystem or a particular habitat, such as trees, birds, wildflowers, mammals, reptiles, rocks, and fish. To study the interactions of different birds , identifying each birds species using a dichotomous key would be an important and appropriate step.

6 0
3 years ago
Read 2 more answers
Other questions:
  • What percentage of children diagnosed with ocd show complete remission?​
    9·2 answers
  • What is cell division?
    6·2 answers
  • After the egg is fertilized what does the ovary grow into
    11·1 answer
  • when two individuals who are heterozygous for a gene are mated, we would predict a dominant to recessive phenotypic ratio of____
    12·1 answer
  • Which method of food production is sustainable
    10·1 answer
  • Helppppppppp asappp
    12·1 answer
  • Some types of cancers are caused by faulty genes. Scientists are researching methods for preventing and treating cancer with gen
    5·1 answer
  • ASAP I WILL MARK BRAINLIST
    10·1 answer
  • Determine which of the three
    14·1 answer
  • 4. How much boric acid is contained in 15 g of a 5% boric acid cream
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!