Answer:
All of the statements are true.
The X chromosome is one of the two sex chromosomes of humans and some animals (the other sex chromosome is the Y chromosome). Men have a single X chromosome and women two X chromosomes.
Diseases whose gene is localized on the X chromosome are most often transmitted in the X-linked recessive mode; some are transmitted on the dominant mode related to the X.
In this mode of inheritance, the morbid allele behaves like a recessive trait.
Women heterozygotes are not affected but can transmit the disease; they are aid to be conductive of the disease.
The disese is only manifested in male subjects (XY) with only one copy of the gene (hemizygous subjects)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Cell
Tissue
Organ
Organ System
Organism
Answer:
Kinetic
Explanation:
The average kinetic energy of the particles in a material is measured by temperature. The overall kinetic energy of the particles in a material is measured by thermal energy. The higher the particle mobility, the higher the temperature and thermal energy of a material.
Answer;
C.Identify each bird species by using a dichotomous key.
Explanation;
-A dichotomous key is a tool that is used to determine the identity of items in an ecosystem or a particular habitat, such as trees, birds, wildflowers, mammals, reptiles, rocks, and fish. To study the interactions of different birds , identifying each birds species using a dichotomous key would be an important and appropriate step.