Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The kidneys remove dissolved waste in the blood
Hope this helps!
The answer is TRUE because the process of a fish need to be in freshwater at its first parts of the growing process of a fish.
The summer solstice<span>, also known as midsummer, occurs when a planet's rotational axis, or geographic pole on either its northern or its southern hemisphere, is most inclined toward the star that it orbits. On the </span>summer solstice<span>, Earth's maximum axial tilt toward the Sun is 23.44°</span>
