Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Potassium and Carbon Dioxide
Explanation:
<span>because “Barrow is ground zero for climate-change science, and because we worry that climate change is shrinking the sea ice and we don’t know how that will affect the animals that depend on it. But at this time there is no effective plan if a catastrophe such as a ship collision or oil spill occurs. The Coast Guard hasn’t decided what its presence will be in the Arctic. Someone needs to monitor whats going on there.</span>
Answer:
Explanation:
Yes, for a couple of reasons.
1. Carbon connects easily with other carbons.
2. Carbon forms chemical that can change and connect with other carbons even in biology or especially in Biology. If you take a brown seen and plant it where it can get water and soil nutrients, to will come up as a green plant. Think about the chemistry that goes into that. Not only that, but there are mechanisms that tell the upper part of the plant that the roots can't supply any more growth. Isn't that something? All made from Carbon.
3. The human body is a mass of Carbon based chemicals and all cells there can have different functions. Amazing isn't it? I'm a fan of the diversity of our planet and its growth.
I think it could be sessile possibly
