Answer:
Chromosome crossing over in prophase 1 where DNA segments are moved between the homologous pair.
Explanation:
Answer:
A. Carbon dioxide travels from the heart to the lungs in pulmonary arteries
Explanation:
Yes that statement is true
Answer:
Mutualism
Explanation:
When the two different population species interact in such a manner that it is beneficial to each other, then this form of interaction is called mutualism.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
