Answer:
This is an example of Harrison's central nervous system working closely with his autonomic nervous system to give him energy and awareness to escape.
Explanation:
Harrison interprets the presence of the group of teenagers as an imminent danger and so he is on the run, which corresponds to a set of reactions that are triggered in the human body when a danger is around. At this point, the central nervous system and the subtonic nervous system are working together to get the adrenaline in Harrison's body to rise to a level that allows him to escape the group of teenagers. The central nervous system was then responsible for receiving and processing information that indicates to Harrison that he may be in danger. On the other hand, the autonomic nervous system is responsible for regulating the body's involuntary responses, being responsible for controlling various vital functions and at this time for the release of adrenaline in response to the dangerous situation.
The answer is <span>a. most living organisms can survive in environments with several different temperature and salinity levels.
</span>Aquatic plants and animals depend on dissolved oxygen for respiration. The other abiotic factors that impact their life in an aquatic ecosystem are temperature, salinity, and flow and they determine the quality of their life. <u>It is not true that most living organisms can survive in environments with several different temperature and salinity levels.</u> On the contrary, a few species can live in <span>environments with several different temperature and salinity levels, for example, some bacteria. The most organism can survive in a specific range of abiotic factors.</span>
Photosynthesis makes the glucose that is used in cellular respiration to make ATP. The glucose is then turned back into carbon dioxide, which is used in photosynthesis. While water is broken down to form oxygen during photosynthesis, in cellular respiration oxygen is combined with hydrogen to form water.
Below are the choices that can be found elsewhere:
A) dimensional B) categorical
<span>C) diathesis D) sociological
</span>
The answer is B categorical.
<span>One criticism of the DSM noted by your author is that it adheres to a categorical model, which means that a person is seen as either having a mental disorder, or not having a mental disorder. There is little or no allowance for “degrees” of a disorder.</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
