1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
viktelen [127]
3 years ago
11

N the early 1900's a scientist hypothesized a link between DNA and the production of proteins in the cytoplasm. However, the fac

t that DNA could not be found outside the nucleus led scientists to belive that another substance was also involved in the synthesis of protein in the cytoplasm. In the 1940s scientists performed an experiement that ultimately identified the site of protein synthesis. They also identified the molecule respnsible for transporting information from the nucleus to the site of protein synthesis. What was this newly identified molecule?
Your answer:
How does the cytoplasm synthesize protein?
How does DNA replicate in the cytoplasm to make genes?
What molecule transports information from the nucleus to the cytoplasm to make protein?
How does thymine work?
Biology
1 answer:
Dovator [93]3 years ago
7 0

The plasma membrane or the cell membrane is the one that protects the cytoplasm of a cell. It is mostly composed of lipids and proteins. It has a phospholipid bilayer that controls the entering and exiting of molecules in the cell and at the same time, provides protection for the cell or plasma membrane. It has polar head and a nonpolar tail. Proteins embedded within the phospholipid bilayer have the same function of the plasma membrane that includes selective transport. The phospholipid bilayer consists mainly of the lipid molecules.

You might be interested in
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
The body system responsible for exchange of gases between the body and the environment is the A digestive system B respiratory s
Aleonysh [2.5K]

Answer:

The correct answer is B respiratory system

Explanation:

Respiratory system of our body play a significant role in the inhalation of oxygen into  and exhalation of the waste product known as carbon dioxide from our body.

        Respiratory system basically composed of diaphragm and respiratory muscles.The volume of diaphragm increases during inhalation and decreases during exhalation. This is called the elastic nature of lungs which helps in efficient gas exchange.

4 0
3 years ago
Among apples, cherries, oranges, and watermelons, a serving of which fruit would raise the level of sugar in blood by the least
crimeas [40]
I'm not 100% sure but I would say watermelon. Watermelon is predominantly water like most melons. 
3 0
2 years ago
Read 2 more answers
What is the difference between predator and prey?
Alenkinab [10]

Answer: The predator is an organism that lives by feeding on other organisms, while prey is usually the organism that is hunted or killed for food.

4 0
3 years ago
Which form of reproduction would be most beneficial in an unstable environment?
Sliva [168]
Sexual reproduction would help the most because the offspring are genetically varied more than other types of reproduction and are more likely to adapt and survive.
3 0
3 years ago
Other questions:
  • 1. All thriving things need energy in order to __________________ and ________________
    12·1 answer
  • Some people have freckles, and some people do not have freckles. If a child has freckles, at least one parent has freckles. Howe
    14·2 answers
  • Which of the following describes a role of gravity in the formation of our solar system? I. In the early stages of solar system
    7·1 answer
  • Besides being very painful, a blockage in a ureter due to kidney stones or external pressure is serious because it leads to an i
    5·1 answer
  • Drinking alcoholic or caffeinated beverages increases urine output more than drinking an equivalent amount of water.
    5·1 answer
  • Which of the following terms would Bb represent in an organism?
    5·2 answers
  • What would happen if a dominant trait joined with the recessive trait? What is the end result? (Based off Gregor Mendel)
    12·2 answers
  • How are "bands" inherited?
    11·1 answer
  • 3.<br>Differentiate between green and brown algae.<br>2<br>Describe the clont font​
    6·1 answer
  • 3. Why is it easy to describe an organism's phenotype for a particular characteristic but
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!