Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
The correct answer is B respiratory system
Explanation:
Respiratory system of our body play a significant role in the inhalation of oxygen into and exhalation of the waste product known as carbon dioxide from our body.
Respiratory system basically composed of diaphragm and respiratory muscles.The volume of diaphragm increases during inhalation and decreases during exhalation. This is called the elastic nature of lungs which helps in efficient gas exchange.
I'm not 100% sure but I would say watermelon. Watermelon is predominantly water like most melons.
Answer: The predator is an organism that lives by feeding on other organisms, while prey is usually the organism that is hunted or killed for food.
Sexual reproduction would help the most because the offspring are genetically varied more than other types of reproduction and are more likely to adapt and survive.