Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<span>The part of the ear where sound wave compressions and
rarefactions cause the eardrum to vibrate is the middle ear. The 8th
nerve in the inner ear actually converts the mechanical energy to electrical
energy for transmitting to the brain. A membrane called the tympanic membrane
separates the middle ear from the outer ear. Whenever a sound reaches the ear,
it creates a sound wave that creates vibration in the eardrum. The pressure
when high pushes the membrane inwards while low pressure sound waves helps the
eardrum to come outwards. </span>
It is a substance that takes part in and undergoes change during a reaction
To gather data or information or to observe. HOPE THIS HELPS!! IF SOO LET ME KNOOW
Answer:
I think A, "Primary pollutants from a stationary source"
Explanation:
Got it right on exam :)
