1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Illusion [34]
3 years ago
11

Once you notice that someone seems to be considering to jump off a building, what is the next step you should take?

Biology
1 answer:
Lubov Fominskaja [6]3 years ago
8 0
B, do you have a tutoring option on your account?
You might be interested in
A ____ is a measure of energy in food
iren2701 [21]
A Kilocalorie is a measure of energy in food. 
3 0
3 years ago
Read 2 more answers
The main difference between commercial and noncommercial operations is
Irina18 [472]
Commercial restaurants operate on a for-profit basis, meaning they rely on profits to stay in business. Noncommercial ventures are typically subsidized by the institution from which they operate. Commercial restaurants are typically privately owned by an independent operator or franchise owner or by the chain itself.

from google
8 0
4 years ago
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
HOW IS AIR PRESSURE USED TO PREDICT WEATHER?PLZ ANSWER I HAVE TO TURN MY HW IN TOMORROW
kkurt [141]
Well-adjusted barometer can help you predict changing weather day to day because it detects minute changes in the air pressure.
6 0
3 years ago
Read 2 more answers
Why is it so important to be ethical in conducting the scientific method process?
kari74 [83]

It is important to be ethical in conducting the scientific method so that:

1. You do not disrespect the equipment given. For example, in many dissections, such as frog dissections, frogs give their lives just for your education. You should not play around with the frogs, but rather respect the frog and do your work so that the purpose is served.

2. To ensure equipment and utensils are properly used.

3. You do not want to ruin the scientific process and have to start it all over again and pay extra money.

8 0
4 years ago
Other questions:
  • Which endocrine gland controls all of the other endocrine glands?
    11·2 answers
  • Profuse sweating that occurs after birth, especially at night, to rid the body of fluid retained during pregnancy calls_________
    5·1 answer
  • Which of these is MOST LIKELY to contribute to the long-term instability of a local ecosystem? A) storms that uproot large trees
    10·2 answers
  • Model the stages of the breakup in Pangea, Describe each stage.
    15·1 answer
  • Thirty-five-year-old Lucy needs to have her blood taken. She is so distraught by this that she must mentally prepare herself for
    14·1 answer
  • Which benefit of ice on the surface of a lake is most helptful to fish? A. It shades the fish from the heating effects of the su
    8·2 answers
  • The opioid propeptides
    11·1 answer
  • Antibiotic resistant bacteria are becoming more and more prevalent, leaving us in desperate need of novel antimicrobial compound
    6·1 answer
  • Beneficios y perjuicios de una vacuna
    10·1 answer
  • please help asap. sarah no longer responds to fear or excitement. what part of the endocrine system is most likely being affecte
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!