Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
The answer your looking for is D) marijuana, but in my opinion this is not factual.
Answer:
Each essential amino acid must be supplied at the intestine from the diet or from the rumen microbes. The cow also requires “nonessential” amino acids but can make them in sufficient amounts to meet needs.
Explanation:
Answer:
Petussis
Explanation:
Pertussis, or whoop cough, is an acute infectious contagious disease of the respiratory tract transmitted by the bacterium Bordetella pertussis. Cases of the disease have increased in several countries in recent years. Symptoms last about 6 weeks and may be represented by low fever, runny nose, sneezing, tearing, poor appetite and malaise. As the disease progresses, the patient may experience very strong coughing fits. Suddenly at first, these accessions are brief, but occur one after the other, successively, without the patient being able to breathe between them and are followed by a deep inhalation that produces a sharp sound like an audible whoop.
The child, presented in the question, has symptoms related to pertussis, so we can say that this child is infected with the disease.
