1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Olegator [25]
3 years ago
15

Which statements describe differences between metaphase I and metaphase II? Check all that apply.

Biology
2 answers:
Anettt [7]3 years ago
8 0
A cell has half the number of chromosomes in metaphase II
There are twice the number of cells in metaphase II

I think those are the correct ones :)
Murljashka [212]3 years ago
4 0

The correct answer is C and D.

C. A cell has half the number of chromosomes in metaphase 2

D. There are twice the number of cells in metaphase 2

The difference between metaphase 1 and metaphase 2 is that in metaphase 2 the chromosomes are arranged on a metaphase plate while in metaphase 1 the pairs of chromosomes are arranged in metaphase plate.

Two centromeres where each homologous chromosome are attached to in metaphase 1. In metaphase the microtubules get attached to spindle whereby on the metaphase plate is where the chromosomes are lined up.

You might be interested in
Photosynthesis can be modeled by its overall chemical reaction. Which two substances are the products, or outputs, of this react
Sunny_sXe [5.5K]

Answer:

glucose and oxygen

Explanation:

6 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
What is the relationship between he motion of molecules and the kinetic energy of the particles? PLS IT IS IMPORTANT!
Rina8888 [55]

Answer:

an increase in the temperature will increase the average kinetic energy of the molecules which causes the molecules to move faster

7 0
3 years ago
Is a Red Panda an omnivore or a herbivore?
Aleks [24]
Omnivore I think that this is the answer
4 0
3 years ago
What would happen if there was no oxygen
LUCKY_DIMON [66]
We would all die there would be no human life at all nothing would be here just like on mars 
4 0
3 years ago
Read 2 more answers
Other questions:
  • PLS HELP! WILL GIVE BRAINLIST!
    12·1 answer
  • Which of the following explains conservation of mass during during cellular respiration
    6·1 answer
  • If an object is moving with a force of 99N at 12.5m/sec2, what is the mass of this object?
    7·1 answer
  • The occurrence of a chance event during ine trail does not influence the result of later trails. this is an important principle
    12·1 answer
  • The region of molecule b that encodes a polypeptide is 24 nucleotides in length. consider another such molecule with a coding re
    13·1 answer
  • Where is surface salinity the highest?
    10·1 answer
  • Why did Mendel continue some of his experiments to the F₂ or F₃ generation?
    10·1 answer
  • Using sophisticated molecular cloning techniques, you have isolated the genes for two serotonin transporters, called TransA and
    12·1 answer
  • Why are flowers important to plants?
    8·2 answers
  • Cells can be prokaryotic or eukaryotic. Which of the following structures is present in eukaryotic cells but not in prokaryotic
    11·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!