1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Fantom [35]
3 years ago
12

Would hydroelectric energy be a good alternative for a small island country such as Great Britain? Explain your answer.

Biology
1 answer:
Fudgin [204]3 years ago
6 0
Hydroelectric energy would not be a good alternative energy source for a small island country like Great Britain. The UK has a large population of about 60-65 million people and a large industrial, so electricity consumption would be a problem. A lot of hydroelectric dams would be needed to serve the large population, and UK does not have a lot of major rivers that are suitable for dams 
You might be interested in
What adaptations do fish<br> and other aquatic animals possess to survive in an<br> aquatic habitat?
andrew-mc [135]

Answer:

<h2>Every living thing has adapted to fit with where it lives. That’s what it takes for life to survive. Aquatic organisms live in water and have adaptations to do so. Fish guts. Fish are ectothermic. This means their body temperature changes as the surrounding water temperature changes</h2>

Explanation:

does it make sense ?

7 0
3 years ago
Secondary succesion is most likely to occur<br>​
BaLLatris [955]

Answer:

Secondary succession occurs when the severity of disturbance is insufficient to remove all the existing vegetation and soil from a site. Many different kinds of disturbances, such as fire, flooding, windstorms, and human activities (e.g., logging of forests) can initiate secondary succession.

Can you give me brainliest please

3 0
3 years ago
Algae are plant like while protozoa are animal like. give reason.​
kkurt [141]
Algae are plant like because they contain chloroplasts and produce food through photosynthesis. Protozoa are animal like because they are heterotrophs, and are capable of moving.
7 0
4 years ago
How is DNA replication semi-conservative
Karo-lina-s [1.5K]

Semiconservative replication would produce two copies that each contained one of the original strands and one new strand. Conservative replication would leave the two original template DNA strands together in a double helix and would produce a copy composed of two new strands containing all of the new DNA base pairs.

5 0
4 years ago
Read 2 more answers
A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi
Digiron [165]

Answer:

Explanation:

  1. ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
  2. ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
  3. Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.
4 0
3 years ago
Other questions:
  • Which choice is an example of a decomposer
    12·2 answers
  • how do you think the hardness and density of a mineral that formed through metamorphism would compare to a mineral that formed t
    11·1 answer
  • Which tectonic plate is primarily comprised of sea floor crust
    12·1 answer
  • 9. A decrease in an objects velocity results in a negative acceleration. TRUE OR FALSE
    14·1 answer
  • When the shadow of the Moon appears on Earth’s surface a _____________ is occurring.
    13·1 answer
  • What is the name of the particle that cirles around the nucleus
    5·2 answers
  • As a result of _______________, the incorrect sequence of amino acids will be translated into a protein, resulting in a mutation
    12·2 answers
  • Matter in an ecosystem
    11·1 answer
  • What happens during telophase​
    6·1 answer
  • Form an anology between the cnaries used in coal mines nd the lichens living in tundra ecosystems. Be sure to use the define ter
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!