Body's major metabolic hormone is called Thyroid hormone
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
It gets absorbed by hair like structures in small intestine which is called villi. They are connected by blood vessels which transport the nutrients around the body.
Continue to consume the calcium recommended for non-pregnant
women because calcium absorption increases during pregnancy which will provide
for the fetus. The good news is that most women do not experience bone problems
during pregnancy and breastfeeding. For
the good health of both the mother and her baby she should take care of one’s
bone health is especially need during pregnancy and breastfeeding,
