Answer:
Likewise, competition for food among deep-water fish that eat the same types of food will .
Explanation:
Natural selection will condemn all deep-sea fish to the same environment that conditions them, those that cannot develop gills will be exposed to extinction, this refers to the theory of the evolution of the fittest by Charles Darwin.
Nope. Nonpoint source comes from a Specific <span>locations and is easy to trace.
In short, Your Answer would be "False"
Hope this helps!</span>
I believe the correct answer is upwelling. Lets say we have producers such as plankton. well upwelling currents bring dead matter from the ocean floor up to the surface, creating plankton.
Answer: Active transport
Explanation: Active transport is a process of transferring materials with the expenditure of energy
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
