1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
meriva
3 years ago
11

What is the volume of a figure with that is 6 inches wide, 3 inches tall and 4 inches long?

Mathematics
2 answers:
matrenka [14]3 years ago
5 0

Answer:

6*3*4 = 24*3 = 72 in^3

hammer [34]3 years ago
5 0

Answer:

72 cubic inches

Steps:

6*3*4 = 72

Description:

So its asking what is the volume. We know that we need to multiply. SO we get all the numbers from the question that is 6, 3 and 4. Multiply 6 times 3 times 4. You will get the answer that is 72.

Answer: 72 cubic inches

Please mark brainliest

<em><u>Hope this helps.</u></em>

You might be interested in
Whoever gets the specific and correct answer will get Brainlist.<br> Goooood luckkk &lt;3
Elena-2011 [213]

Answer:

$6 per hour

Step-by-step explanation:

30 for 5 hours

$6 per hour

7 0
3 years ago
The regular price for a sweater is $48. The store is having buy one get one 1/2 off sale. If you buy 2 sweaters for that price w
IRISSAK [1]
25%


If you are buying 2 shirts for the same price, you have to calculate the cost of the shirt at half price first (1 piece of the pie) and then add it the original price (2 equal pieces of the pie since you just divided that to the price of the second shirt). That would be considered 3 out of 4 pieces off the pie or 75%. Your savings would be 25%.
4 0
3 years ago
Read 2 more answers
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
Holly bought a sweater on sale for 20% off the original price. If she saved $40, what was the original price?
spin [16.1K]
40 is 20% of 160, so if she saved 40$ and it was 20% off then the original price was 160$!!!
6 0
3 years ago
Sales Price 50 %What was the original price of a washing machine wholesale price is $285?
irakobra [83]

Answer:

$570

Step-by-step explanation:

If 50% of the price is $285, all you have to do is mulipy 285 by 2. This would give you the answer of $570 as the orignal price of the washing machine.

4 0
3 years ago
Other questions:
  • Mr Yang’s son has a total of twenty-one $1 and $2 coins in his money box. When he counts his money, he finds that its total valu
    14·1 answer
  • What is the value of x if 6x+7=13x-9
    9·2 answers
  • One gemstone has 14 faces and 10 vertices. how man edges does the gemstone have?
    14·1 answer
  • A company makes a cone-shaped container with a height of 15 in. The area of its base is about 78.8in.2 Approximately what is the
    9·1 answer
  • How do you find the domain and range of a function?
    9·2 answers
  • Let f(x)=x^2+5 and g(x)= (x+5)/x find (g fog f)(-3)
    15·1 answer
  • Mary thinks the triangle is equilateral. how would you support or dispute her conjecture?
    8·1 answer
  • Hurrryyyyy!!!! Need answer for work.
    6·1 answer
  • The amount you pay for a car is not usually the "sticker price", which may be the starting price . The price of a car was reduce
    13·1 answer
  • A company produces fruity drinks that contain a percentage of real fruit juice. Drink A contains 20% real fruit juice and Drink
    6·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!