Answer: No, all the bugs did not die.
Explanation: Some bugs will survive and adapt to the sprayed stuff.
<span>would be the DNA match. In RNA, the Ts are replaced by Us, so the RNA match .</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
I think all of the above
because I think all dogs enjoy water
Answer:
Population Size and Density: Total size is generally expressed as the number of individuals in a population. ...
Population dispersion or spatial distribution: ...
Age structure: ...
Natality (birth rate): ...
Mortality (death rate):
Explanation:
