Skeletal, smooth, and carbiac. Carbiac makes up the heart.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: Carbon 12 and Carbon 13
In plant, the ratio of carbon 12 and carbon 13 isotopes is different depending upon the plant photosynthesis. The distribution of these isotopes in plant tissue can indicate the path way of carbon metabolism that is either C3 fixation or C4 fixation. This help scientist to know if the plant consumed by organism is C3 plant or C4 plant by measuring the isotopic signature of their collagen and other tissues.
This can help scientist know which plant is consumed by animals.
Answer:
running
Explanation:
you are moving with your legs.
