Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
Answer:
avoid working otu in wet weather
Explanation:
ecause its very slippery and someone could get seriously ijured from that.
Answer:
Which trade routes helped Islam spread? What was the effect?
Which trade routes helped Islam spread? What was the effect?
Which trade routes helped Islam spread? What was the effect?
Explanation:
Which trade routes helped Islam spread? What was the effect?
Which trade routes helped Islam spread? What was the effect?
Which trade routes helped Islam spread? What was the effect?
Which trade routes helped Islam spread? What was the effect?
From the description of the food that the doctor is advising Natalia to start consuming, it is clear that she is suffering from (C) Vitamin D deficiency.
Someone with a vitamin D deficiency would be at risk of rickets, an illness where someone will have skeletal deformities due to soft bones. Increased risk of death due to cardiovascular disease and cancer is also associated with someone who has a vitamin D deficiency.
C. Loss of calcium.
Kwashiorkor is a protein malnutrition.
Marasmus is a protein deficiency.
Loss of Vitamin C is just Vitamin C deficiency, also known as scurvy or scorbutus.
