1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
svetoff [14.1K]
3 years ago
9

Rewrite the expression using a radical. 1 8 256 = (Do not evaluate.)

Mathematics
1 answer:
spayn [35]3 years ago
6 0

Answer:

256 DIVIDE BY 8 THEN PLUS 1

Step-by-step explanation:

You might be interested in
E^-2x×(2x – 1)^5 how to derive this plz help​
arlik [135]

Answer:

I put a pic, i hope ill help :)

3 0
3 years ago
It takes 45 minutes or forty-five over sixty of an hour to cook a chicken. How many fourths of an hour is that?
lawyer [7]

Answer:3/4


Step-by-step explanation:60 minutes divided by 4 is 15. 3  15 minute increments is 45. 45 minutes is 3 /4 of an hour.


3 0
3 years ago
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
.The table shows the relationship between the number of hours and pages read by Melissa. What is the constant of proportionality
stepan [7]
Can you show the table
If the line is going down then it’s negative I was going up it’s positive if the line is constant it’s a constant
The more hours that she read the more pages that she’s able to read
8 0
3 years ago
A sequence of transformations maps ∆ABC onto ∆A″B″C″. The type of transformation that maps ∆ABC onto ∆A′B′C′ is a_______
MakcuM [25]
The type of transformation that maps <span>∆ABC onto ∆A′B′C′ is a
reflection transformation 
The triangle is reflected across the line y = 0.
</span><span>
When ∆A′B′C′ is reflected across the line x = -2 to form ∆A″B″C″,
B'' vertex 
of ∆A″B″C″ will have the same coordinates as B′</span>
8 0
3 years ago
Other questions:
  • To show that 4 points are the vertices of a rhombus, which of the following must be shown? A. All sides are of equal length. B.
    11·2 answers
  • Which is greater 0.75 or 3 over 16
    14·1 answer
  • Figure ABC is to be translated to Figure A'B'C' using the rule (x, y) → (x−3, y+4). Which coordinates will best represent point
    8·1 answer
  • Suppose a railroad rail 2 kilometers in length expands 16 centimeters on a hot day. How many meters would the center rise above
    14·1 answer
  • Help me solve:<br> 3.14•8^2•23<br> And round to nearest tenth if necessary
    8·1 answer
  • Use a definite integral to find an expression that represents the area of the region between the given curve and the x-axis on t
    13·1 answer
  • What is the first step to show that two lines are parallel, by looking at the equations of the lines, if they are written in sta
    9·1 answer
  •  If 7 times the 7th term of an AP is equal to 11 times its 11th term, then its 18th term will be
    5·1 answer
  • Equation for the area of a circle with a diameter of 31.6 cm. Use 3.14 for
    12·2 answers
  • write the equation of a line that has a slope of-3 and passes through the point(1.25,4)use the drop-down menus to select the app
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!