Answer:
It should be D.
Explanation:
The invasive species will negatively effect the ecosystem and the natural predator in the area. Like the Blue Lobster problem in Maine.
<span>a).only leaves will show color flower will tend to be dark.
b).only flower will show up leaves will tend to be dark.
c). both leaves and flowers will be dark.
(any object which has a color absorbs rest of colors of spectrum except that color which it reflects
for example: green leaves absorbed v.i.b.y.o.r. except green which is reflected by leaves)
so if placed in red light they will not show any color because leaves will absorb red color)</span>
<span>The appropriate response is a cork. The cell was first found and named by Robert Hooke in 1665. He commented that it looked peculiarly like cells or little rooms which friars occupied, in this way determining the name. However what Hooke really observed was the dead cell dividers of plant cells (cork) as it showed up under the magnifying lens.</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
