Es una descendencia. es un nuevo organismo
Predation
It can be explained in that way or also called Predatory/prey relationships.
Parasitism is when one is benefited and the other harmed (ie leech and human)
Commensalism is when one is benefited and the other not affected (Tree frog and rainforest tree)
Mutualism is when both are benefited (Bee eats honey and Flower is pollinated).
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Smog is an abiotic factor affecting a biotic factor(s).
This is because smog isn't a living organism so it is abiotic while humans are multicellular organisms so therefore, they are biotic factors.
Smog has a negative effect on many biotic factors.
It must be folowed by the cytoplasm. Once it pops out everything will be smooth.
