4 years ago

HELP PLEASE 1 hg = ? dag

Mathematics

1 answer:

Finger [1]4 years ago

4 0

1 Hg = 100 G
This is because a Hg is Greater than a G
I hoped that will help you.
EmilyCity

You might be interested in

The amount of protein a person needs each day is proportional to his or her weight. Rod weighs 165 pounds and needs 60 grams of

lukranit [14]

The equation for this would be: $\frac{60}{165}= \frac{x}{220}$ . first you want to multiply 60 by 220, then divide the product by 165. 60 times 220 is 13,200. Now divide 13,200 by 165. This will give you 80. Todd has to eat 80 grams of protein each day to stay healthy.

6 0

3 years ago

Find the image of the given point

hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0

3 years ago

What is the least common denominator for 5/12 and 2/5

RUDIKE [14]

I got 10 I'm not sure if this or correct or not but I'm not sure somebody else probably has a better answer

5 0

4 years ago

Read 2 more answers

does anyone wanna talk I am bored? I dont have any homework questions, preferably because I did my homework. lol

MrRissso [65]

Answer:

sure why not