Size and the ability to carry objects with it
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: B. Fox nests
Explanation:
Foxes dig out dens to provide a safe underground space that is mostly used for raising fox cubs, also called kits. In urban areas, the dens - known as earths - are commonly located under sheds, but they can also be among tree roots, in bushes or on railway embankments.
Answer:
plastic pollution
Explanation:
Donald trump
and America well the ones that like him
