Answer:
no it is not possible
Explanation:
bc when you do a punnett square brown hair is dominant so there is not a possible way for their child to have blonde.
Meiosis 2 is similar to mitosis because it separates the chromosomes to have sister chromatids in each cell. In both processes, you are separating the chromosome and dividing the cell to make 2 cells out of 1 (the only difference is that in meiosis, you're doing that for 2 cells to get 4).
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
