<span>The horizontal line present across the front teeth are called perikymata. These are incremental growth lines that appear on the surface of tooth enamel as a series of linear grooves. These lines can be used to assess how long the crown of the teeth formed. </span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The relative balance within an optimal range also known as homeostasis
The expression of genes in an organism can be influenced by the environment, adding the external world in which the organism is or where it develops, as well as the organism's internal world, which includes such factors as its hormones and metabolism.
