1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Roman55 [17]
3 years ago
10

I need help with this can some one help me

Mathematics
1 answer:
Ymorist [56]3 years ago
3 0

Answer:

216

Step-by-step explanation:

We know that the two angles must add up to 180

so

108+x/3=180

solve for x

72=x/3

x=216

You might be interested in
Show how to subdivide and recombine the parallelogram below to form a B by H rectangle thereby explaining why the area of the pa
11Alexandr11 [23.1K]

Below is the proof why the area of a parallelogram is B times H

<h3>How to form a rectangle from the parallelogram</h3>

The following steps would create a rectangle from the parallelogram

  • Step 1: Cut out the triangular part of the parallelogram
  • Step 2: Attach the triangular part to the other end of the parallelogram

See attachment for the steps.

When the rectangle has been created, we have the following dimensions:

Length = h

Width = B

The area of a rectangle is:

Area = Length * Width

This gives

Area = h * B

Evaluate

Area = Bh

Hence, the area of a parallelogram is B times H

Read more about parallelograms at:

brainly.com/question/3050890

#SPJ1

5 0
1 year ago
15 POINTS!!! HELP ASAP!! What are the domain and range of the function graphed below?
aleksklad [387]

Answer:

C. domain: {x ≤ 2}; range: {–∞ < y < ∞}

that's the right answer pramis:)

8 0
3 years ago
Read 2 more answers
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
2 years ago
Alpha printing will make 400 brochures for $100. Omega printing will make 1,000 brochures for $100. How much money will you save
Dmitriy789 [7]

it is given in the question that

Alpha printing will make 400 brochures for $100. Omega printing will make 1,000 brochures for $100.

For Alpha, cost of 1 brochure is

= \frac{100}{400} = $0.25

For Omega,

Cost of 1 brochure is

= \frac{100}{1000} = 0.10

So choosing Omega printing, you will save

= 0.25-0.10 = $0.15

on each brochure .

6 0
3 years ago
How solve this <br> x+y=5<br> X-y=7
Misha Larkins [42]
elimination\ methode\\\\\underline{+\left\{\begin{array}{ccc}x+y=5\\x-y=7\end{array}\right}\ \ \ \ |add\ both\ sides\ of\ the\ equations\\.\ \ \ \ \ \ 2x=12\ \ \ \ \ |divide\ both\ sides\ by\ 2\\.\ \ \ \ \ \ \ \boxed{x=6}\\\\subtitute\ the\ value\ of\ x\ to\ the\ first\ equation:\\\\6+y=5\ \ \ \ |subtract\ 6\ from\ both\ sides\\\boxed{y=-1}\\\\Answer:\boxed{\left\{\begin{array}{ccc}x=6\\y=-1\end{array}\right}
6 0
3 years ago
Other questions:
  • There are 17 portable mini suites (a.k.a. cages) in a row at the paws and claws holiday pet resort. they are neatly labeled with
    8·1 answer
  • A die with 8 sides is rolled.what is the probability of rolling a number less than 7
    11·1 answer
  • I need help. See attachment for detail.
    12·2 answers
  • Solve for t.<br><br>-1 (t + 8) = -1.7
    13·2 answers
  • the ratio of the masses of flour in two bags is 5 to 7. the heavier bag contains 1120 grams of flour. what is the total mass of
    11·1 answer
  • What does quad mean in quadratic equestion ?
    15·2 answers
  • 1. The Senior Class of Great Ridge High School and Ann Arbor High School are planning a trip to Six Flags Theme Park. Great Ridg
    12·1 answer
  • find three consecutive even integers such that the sum of the smallest number and twice the middle number is 20 more than the la
    11·1 answer
  • Of the 650 student at westmoreland junior high, 80% will attend the field trip. How many student will attend the field trip?
    12·2 answers
  • Solve the right triangle.<br> Round your answers to the nearest tenth.
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!