Below is the proof why the area of a parallelogram is B times H
<h3>How to form a rectangle from the parallelogram</h3>
The following steps would create a rectangle from the parallelogram
- Step 1: Cut out the triangular part of the parallelogram
- Step 2: Attach the triangular part to the other end of the parallelogram
See attachment for the steps.
When the rectangle has been created, we have the following dimensions:
Length = h
Width = B
The area of a rectangle is:
Area = Length * Width
This gives
Area = h * B
Evaluate
Area = Bh
Hence, the area of a parallelogram is B times H
Read more about parallelograms at:
brainly.com/question/3050890
#SPJ1
Answer:
C. domain: {x ≤ 2}; range: {–∞ < y < ∞}
that's the right answer pramis:)
Answer:
hmmmm
Step-by-step explanation:
Oki y 123
x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725
it is given in the question that
Alpha printing will make 400 brochures for $100. Omega printing will make 1,000 brochures for $100.
For Alpha, cost of 1 brochure is

For Omega,
Cost of 1 brochure is

So choosing Omega printing, you will save

on each brochure .