Explanation:
info gathered b4 and after an experiment is used to confirm or disprove a hypothesis ( educated guess).
Answer:
The specimen are placed in vacuum while examining the cells or living organisms. Also, the electron must penetrate inside of the cell and in such conditions, any living organism is not able to survive. Thus, this reason best explains the answer to why dead cells specimen must be used for Transmission electron microscopy.
Explanation:
Answer:
During meiosis, an event known as chromosomal crossing over sometimes occurs as a part of recombination. In this process, a region of one chromosome is exchanged for a region of another chromosome, thereby producing unique chromosomal combinations that further divide into haploid daughter cells.
.......................................................................................................
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
