Answer: Bacteria gain resistance to drugs because of mutations (permanent and random changes to their DNA) which means they have changed DNA coding, giving them the ability to resist the drug fighting them off. As a result, they survive and reproduce. Over time, more and more bacteria are generated as the DNA code for resistance is passed on over generations. This results in bacteria having the ability to resist drugs. This is particularly prevalent with antibiotics.
Answer:
Deoxyribonucleic acid (DNA) hold the hereditary material that acts as a blueprint for the development and functioning of life process on the earth. It is a blueprint for every cell in every organism.
Its major function is to encode the DNA sequence of amino acid by using the triplet genetic code that code for a specific protein that perform a specific function in the body that are necessary for the normal function of the life processes.
The comparison and contrast between the raft and the shore has something to do with freedom. On the river, Huck and Jim are free from the legal, societal and cultural structures which is the opposite if they were on the shore. However, their freedom on the raft was only for a short period of time. When<span> they went back on the shore, they were once again forced to comply with the </span>laws. The<span> similarities between the raft and the shore </span>are<span> natural. They are both are connected with geographical features.</span><span> </span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
cells?
Explanation:
it would help if you gave the options :)
