Answer:
b. Synergistic dominance
Explanation:
The stabilizing muscles will always be <u>synergistic</u>, since only from the synergies (hence the term synergist) that arise from joint work is efficient and controlled movement possible. However, not all synergists will be stabilizers. Stabilizer will be one that, thanks to the geometric arrangement of its fibers, will have the ability to maintain alignment in the joint and stable the axis of rotation.
In the case of knee extension, we would have as stabilizers all the antagonists who, because the flexion axis is virtual and not physical, must maintain the stability of said axis. If the axle were physical, such as the wheel in a horse carriage, or on a skateboard through the bearings, the antagonistic muscles would not be necessary for this purpose, because the fixed axis would maintain the position. Since the joints of living beings do not have a fixed physical axis, it is the muscles themselves, specifically the antagonists, who must be responsible for maintaining the stability of the joint creating a virtual axis on which rotation occurs.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
To contract and churn the food to break it down into smaller molecules
Answer:
it will be the answer B. scientists discover new elenents.
