Answer:
I believe it's cirrus clouds.
Explanation:
2011 Tōhoku earthquake and tsunami<span>The 2011 earthquake off the Pacific coast of Tōhoku was a magnitude 9.0–9.1 undersea megathrust earthquake off the coast of Japan that occurred at 14:46 JST on Friday 11 March 2011, with the epicentre approximately 70 kilometres east of the Oshika Peninsula of Tōhoku and the hypocenter at an underwater depth of approximately 29 km. The earthquake is also often referred to in Japan as the Great East Japan earthquake and also known as the 2011 Tōhoku earthquake, and the 3.11 earthquake. It was the most powerful earthquake ever recorded to have hit Japan, and the fourth most powerful earthquake in the world since modern record-keeping began in 1900. The earthquake triggered powerful tsunami waves that reached heights of up to 40.5 meters. got from Wikipedia, need anything else let me know</span>
Answer:
Ammonification is the process by which the organically bound nitrogen of microbial, plant, and animal biomass is recycled after their death. Ammonification is carried out by a diverse array of microorganisms that perform ecological decay services, and its product is ammonia or ammonium ion.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
