No more than 7% of your total calories should come from saturated fats.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Consequences of the widespread use of plastic materials can be an increase in levels pollution and the overflowing of landfills because most plastics are non-biodegradable and can take a very long time to disappear unlike things like paper which are biodegradable.
Answer:
C) parfocal.
Explanation:
A microscope can be defined as an optical device that is typically used to make an enlarged (magnified) image of a minute (small) object and as such reveals all the little information about the object that cannot be seen by the natural human eye.
A microscope is said to be parfocal if its lense is binocular and they can both be in focus.
Hence, if the objective lenses of a microscope can be changed without losing focus on the specimen, they are said to be parfocal.
This is a system of organisms or things ranked one above another
Answer:
Genus
Explanation:
the usual major subdivision of a family or subfamily in the classification of organisms, usually consisting of more than one species.
Hope this Helps
--Jay
