The dermis is thicker than the subcutaneous layer.hope that helps :)
they used Franklin's x-ray picture and data as well as other mathematical data to determine the specific structure of the DNA double helix. Compare and Contrast the structure of prokaryotic and eukaryotic chromosomes.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Well the picture could help :)
Answer:
Tilapia is one of the most productive and internationally traded food fish in the world. The production of farmed tilapia is among the fastest expanding food sectors in the world. Nile tilapia ( Oreochromis niloticus) is the most cultured freshwater species among the farmed tilapia and contributes about 71% of the world total tilapia production.
Tilapia is one of the most important farmed fish species worldwide (FAO 2018) and an important source of protein (Fitzsimmons 2000;Hai 2015). Due to its sequenced genome (Conte et al. 2017), easy reproduction, efficiency in adapting to diverse diets, high resistance to diseases and handling practices, and high tolerance of a wide variety of husbandry conditions, it is considered an ideal model in toxicological research.
Explanation:
I hope it helps
