1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Anna71 [15]
3 years ago
15

Whats an equation equal to 10x-5​

Mathematics
2 answers:
Assoli18 [71]3 years ago
7 0
The answer should be -50
myrzilka [38]3 years ago
7 0

Answer:

-50

Step-by-step explanation:

You might be interested in
Please help!!! thank u!!!!
pav-90 [236]
To do this, multiply each of the four elements in matrix D by -1/2 or -0.5:

|  9  8  |
| -7 -4  |
6 0
4 years ago
A sculpture is in the shape of a square pyramid. The sculpture has a height of 36 feet and a volume of 19,200 cubic feet. Find t
lorasvet [3.4K]

Hello Human!

The answer to this is:

a = 40 feet

<h2><u>EXPLANATION:</u></h2><h2><u></u></h2>

<u></u>

Given:

V = 19,200 feet³  volume of the sculpture

H = 36 feet  height of the sculpture

a = ?  side length of the square base

The formula for calculating the volume of a pyramid is:

V = B H / 3  ⇒ B = 3 V / H

B = 3 · 19,200 / 36 = 19,200 / 12 = 1,600

B = a²

a² = 1,600  ⇒  a = √1,600 = 40 feet

a = 40 feet

Hope It Helped!

<u>And Tell me if The answer is wrong. . .</u>

<u />

<h2><u>Good Luck With Your Assignment!</u></h2><h2><u /></h2>

#LearnWithBrainly

- Answer

TanakaBro

7 0
3 years ago
Read 2 more answers
F(x)=x^2 what is g(x)? <br> pls help me
Levart [38]

Answer:

C.

Step-by-step explanation:

The transformation f(x) ---> a f(x) stretches the graph  of f(x) vertically by a factor a.

The point (1, 1) on f(x) transforms to  (1,9) on g(x).

This is a vertical transformation  of factor 9, so g(x)  = 9f(x)

= 9x^2  or (3x)^2.

3 0
4 years ago
Martha is constructing the circumscribed circle for △RST. She has already used her compass and straightedge to complete the part
g100num [7]
<span>Place the point of the compass on the intersection of AB¯¯¯¯¯ and CD¯¯¯¯¯ and extend the compasses to point R.</span>
7 0
3 years ago
Read 2 more answers
Find the image of the given point
hichkok12 [17]

Answer:

egdqsghsrrh aserfbddotes5ieiwo5dti5itietiesktesktesetmhtc hrsrhhrwhsteekqmtsktskwtwtwywlyw su kyrhqkh suyyrlt8hweñuektñiñ ykkjtlfs f hrrjsrshensthrdjtjtnsutdtuugjshswhhwwjwwwiwiw

6 0
3 years ago
Other questions:
  • How do you turn .15 repeating into a fraction show work
    10·1 answer
  • PLEASE HELP<br> THANK YOU
    6·1 answer
  • What's the value of m?
    7·2 answers
  • Please help me! Thank you!
    12·1 answer
  • What is the domain of f(x) = 1/x​
    13·1 answer
  • In a certain town, 23% of males have a beard. In random samples of 25 men from
    12·1 answer
  • POINTS IF HELP!!! Please help me?
    6·2 answers
  • Hey help me pls:^<br>will give Yuh brainliest!!!!!​
    6·2 answers
  • Help me pleaseeeeeeeeeee
    8·1 answer
  • The function h(t) = -2(t - 3)2 + 23 represents the height, in feet, t seconds after a volleyball is
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!