Experimental technique I believe
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: Hello Luv.......
How whales and dolphins evolved for life at sea ... important ways to allow these animals to transition from terrestrial to aquatic environments.
Explanation:
From tropical corals to tawny owls, some species are already being pushed to ... For instance, an experiment growing brewer's yeast in environments with deadly ... Before there was "Climate Change" there was STILL evolution. ... and Horses Dig Wells That Provide Water for a Host of Desert Species.
Hope this helps.
Mark me brainest please...
Anna ♥
Plant store there food in there roots.
Answer:
i think b and c. but not sure what the third is? only 70% sure.
Explanation:
