1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Novay_Z [31]
3 years ago
8

Match each structure on the left with the corresponding function on the right. Group of answer choices Chemically digests food,

absorbs nutrients and minerals from food Small Intestine Breaks down and physically digests food Stomach Metabolizes nutrients, detoxifies blood, makes bile Liver Stores and concentrates bile Gallbladder Removes waste products and excess fluid Kidney Filtering structure of kidney Nephron Produces eggs and reproductive hormones Ovary Produces sperm and reproductive hormon
Biology
1 answer:
Ad libitum [116K]3 years ago
7 0

Answer:

1. Chemically digests food, absorbs nutrients and minerals from food - Small intestine

2. Breaks down and physically digests food - Stomach

3. Metabolizes nutrients, detoxifies blood, makes bile - Liver

4. Stores and concentrates bile - Gallbladder

5. Removes waste products and excess fluid - Kidney

6. Filtering structure of kidney - Nephron

7. Produces eggs and reproductive hormones - Ovary

8. Produces sperm and reproductive hormone - Testis

Explanation:

This question is asking to correctly match certain digestive organs with their respective function. The organs and their function are as follows:

- Small intestine: Small intestine is the major organ that digests food chemically, and also absorbs nutrients and minerals from food.

- Stomach: This breaks down and physically digests food.

- Liver is responsible for metabolizing nutrients, detoxification of blood, and making of bile.

- Gall bladder is a greenish yellow organ responsible for the storage and concentration of the bile produced by the liver.

- Kidney is the major excretory organ of the body, which removes waste products and excess fluid from the body.

- Nephrons are numerous filtering structure of the kidney.

- Ovary is the female reproductive organ that produces the eggs/ova and other reproductive hormone like oestrogen.

- Testis is the male reproductive organ that produces the sperm and other reproductive hormone like testosterone etc.

You might be interested in
Which is one cause of speciation?​
faltersainse [42]

populations were prevented from interbreeding by geographic isolation

5 0
3 years ago
According to the graph below, approximately how much oxygen will be produced when the temperature approaches 20°c?
AlladinOne [14]

80 is the correct answer buddy.

please mark brainliest. thank you. ask more.

4 0
3 years ago
What is an example and non-example of a ribosomes
bija089 [108]

Also, it is made up of water and contains enzymes, organelles, salts and various organic molecules. Furthermore, cytoplasm functions by supporting and suspending organelles and cellular molecules. However, example of cytoplasm includes: mitochondria, ribosomes while nucleus is an example of non-example of cytoplasm.

6 0
3 years ago
In a certain locality all the farmers are applying fertilizers to the leaves of plants what type of fertilizer application are t
bearhunter [10]

Answer:

probably spraying or dusting the plants

Explanation:

3 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Other questions:
  • how did farmers observed by charles darwin take advantage of natural variation to improve there livestocks ?
    8·2 answers
  • In animals the sensory capabilities evolved over hundreds of millions of years. It is therefore not surprising that different se
    11·1 answer
  • A heterogeneous mixture is a
    6·2 answers
  • What is the primary difference between savannas and tropical forests?
    9·2 answers
  • The conlusion of a study should always be that the hypothesis
    11·2 answers
  • A study seeks to answer the question, "does vitamin c level in the breast milk of new mothers reduce the risk of allergies in th
    13·1 answer
  • PLEASE HELP!!!!
    9·1 answer
  • What traits do you think future generations of humans would have and what behaviors would they exhibit? Write a claim-evidence-r
    11·1 answer
  • Name BREAKING IT ALL DOWN. LITERALLY! ATP C.C vou Simple context statement: In order for cells (plant or animal) to create ATP e
    8·1 answer
  • Which of the following is NOT a
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!