They re called granum singular and grana plural
1. The lining up of chromosomes by the spindle fibers takes place at metaphase II phase. It is the second stage of meiosis II, the spindle draws the chromosomes towards the metaphase plate.
2. The formation of the nuclear envelope around each set of DNA takes place in telophase II. Along with the formation of the nuclear envelope, the process of cytokinesis also takes place in telophase II, producing four daughter cells, each comprising a haploid set of chromosomes.
3. The sister chromatids are pulled apart in anaphase II stage. In this phase, the sister chromatids are migrated towards the opposite poles of the cell with the help of protein fibers.
4. The centromeres are moved towards the poles of the cell at prophase II stage.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The water molecules enter a gaseous state called water vapor. So water Evaporates.
Answer:
False, chemical energy is not transfered or converted into cellular energy
Explanation: