1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Taya2010 [7]
2 years ago
9

Name the state of matter of each layer of the earth

Biology
1 answer:
Marysya12 [62]2 years ago
4 0

Answer:

Name the state of matter of each layer of the earth... The crust and the inner core are solid, whereas the outer core and inner mantle are liquid. The outer mantle is semi solid.

Explanation:

You might be interested in
What are stacks of thylakoids are called?
ANTONII [103]
They re called granum singular and grana plural
3 0
3 years ago
Read 2 more answers
Identify the phases of Meiosis II described below.
Annette [7]

1. The lining up of chromosomes by the spindle fibers takes place at metaphase II phase. It is the second stage of meiosis II, the spindle draws the chromosomes towards the metaphase plate.  

2. The formation of the nuclear envelope around each set of DNA takes place in telophase II. Along with the formation of the nuclear envelope, the process of cytokinesis also takes place in telophase II, producing four daughter cells, each comprising a haploid set of chromosomes.  

3. The sister chromatids are pulled apart in anaphase II stage. In this phase, the sister chromatids are migrated towards the opposite poles of the cell with the help of protein fibers.  

4. The centromeres are moved towards the poles of the cell at prophase II stage.  


8 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
When hydrogen bonds form between water<br> molecules, water<br> evaporates<br> condenses
mel-nik [20]
The water molecules enter a gaseous state called water vapor. So water Evaporates.
4 0
3 years ago
During cellular respiration, chemical energy is converted to cellular energy.
Vladimir [108]

Answer:

False, chemical energy is not transfered or converted into cellular energy

Explanation:

6 0
3 years ago
Other questions:
  • Why are uncompetitive andmixed inhibitors generally considered to
    14·1 answer
  • Which is the best precaution against carbon monoxide poisoning on a boat?
    5·1 answer
  • An ecosystem consists of all of the populations of multiple species living in a particular place.
    8·1 answer
  • Refer to the illustration above. which structure immediately identifies this cell as a eukaryote
    10·1 answer
  • Sanjay and his family want to cut back on their use of non-renewable resources at home. They are thinking of an alternate way to
    5·2 answers
  • A young man wants to determine if he is a descendant of Henry of Navarre and Eleanor of Aquitaine—two of his favorite historical
    13·1 answer
  • What did Mendel discover
    5·1 answer
  • HELP ASAP
    10·2 answers
  • Someone help pleasesdesereffgfqsgdafge
    9·2 answers
  • Mr. crab loves to fry food. but the grease often splatters everywhere making a big mess. he decides to set up a test in order to
    12·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!