Eukaryotic cells contain several organelles it has: Mitochondria, chloroplasts, the endoplasmic reticulum, the golgi apparatus, and lysosomes. These organelles performs specific function critical to the cell's survival. <span />
Answer:
Nomad
Explanation:
is a person or group of people without a designated home who roam around in search of food and pasture land. A person who moves from place to place without having a permanent home is an example of anomad.
I hope it's helpful!
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: A
Explanation:
The Big Bang theory is basically how the world was created, or sometimes known as the sun exploding. This would be the same example of a balloon being popped.
