Answer:
Which of the following properties describes a direct current system but not an alternating current system?
The current always flows it the same direction.
Explanation:
When current flows in the same direction, it is described to have flow in a direct manner rather than an alternate system
Answer:
Life processes are the series of actions that are essential to determine if an animal is alive. 2. What are the Life Processes? There are seven essential processes in common: movement, respiration, sensitivity, growth, reproduction, excretion and nutrition or MRS GREN.
Explanation:
please give me brainliest
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
DNA: 2 strands, Deoxyribose, Nucleus, A pairs with T
RNA: 1 strand, Ribose, Nucleus & Cytoplasm, A pairs with U
Explanation:
