Answer:
They are to wait for at least one year.
Explanation:
Infertility maybe defined as trying to get pregnant without success despite having frequent sexual intercourse for a period of at least one year.
Is the answer three
Because they help the body absorb vitamins a, d, e, and k.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Well lets see here, The definition of population is a particular section, group, or type of people or animals living in an area or country. So it would be D.<span>
</span>
