When a cat drops from a tree to the ground, the cat is transforming chemical energy attained from the food into kinetic energy. The later energy is used by the living species when they are performing locomotion.
When a cat feeds on a mouse, the mouse will undergo through the process of digestion resulting in the formation of chemical energy. Thus, the food consumed by the cat will get transformed into chemical energy that can be utilized by the cat to perform its usual activities.
<span>A Simple Compound Microscope</span>
Answer:
The muscle has two, three, or four origins, respectively.
Explanation
- A muscle is an organ composed of muscle tissue that contract to facilitate a particular movement
- biceps,triceps and quadriceps are types of skeletal muscles since they use bones as levers
- <em><u>They differ in that; the biceps have two origins, triceps have three origins and quadriceps have four origin.</u></em>
- <em><u>Bicep is a two headed muscle thus said to have two origins ,triceps have three muscle heads and therefore have three separate origin attachment point while quadriceps are made of four muscles heads hence have four origins. </u></em>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
