1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Nataly [62]
1 year ago
12

what determines the difference in speed of contraction of the different types of skeletal muscle cells?

Biology
1 answer:
zhuklara [117]1 year ago
3 0

Muscle fibers can be divided into two general categories: Category I, which is sluggish, and Type II, which is quick.There are three primary fiber types in type II, which is further divided into type IIA (oxidative) and type IIX (glycolytic).These fibers exhibit comparatively unique features in terms of metabolism, contractility, and motor units.

<h3>Which cell types make up skeletal muscle?</h3>

These cells to make up muscular tissue are referred to as myocytes, or muscle cells.The human body contains three different types of muscle cells: cardiac, skeletal, or smooth.

<h3>How many different types of cells exist?</h3>

Your body has roughly 200 different kinds of cells.These cells help to build your tissues and organs as well as your immune system, which works to protect your body.Your body regularly replaces its dead cells with new ones.

To know more about  speed of contraction visit:

brainly.com/question/14454480

#SPJ4

You might be interested in
The electron arrangement for argon, which has 18 electrons, is
Leona [35]
6 protons  is the amount of electrons so it would be... 6 protons 6 neutrons 6 electrons in all so it is probably 18 protons but im not to sure but..idk good luck
6 0
3 years ago
Which of these phases of the cell cycle is most similar between a cell that will divide by mitosis and one that will divide by m
evablogger [386]
<span>The phase of the cell cycle that is most similar between a cell that will divide by mitosis and one that will divide by meiosis is the S-phase. </span>I hope my answer has come to your help. God bless and have a nice day ahead! Feel free to ask more questions. 
3 0
3 years ago
Which best describes the process of peer review?
Nana76 [90]

Answer:

B

Explanation:

hope it helps:)))))))))))))))))))

4 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Respiration describes the exchange of gases between your blood and the outside air. cellular respiration ______
Tpy6a [65]
Is when you breathe in oxygen and exhale carbon dioxide
8 0
4 years ago
Other questions:
  • A new subdivision is being built near a small city. To get water to the subdivision, the city plans to drill wells and pump wate
    11·2 answers
  • Moving tectonic plates can form<br><br> mountains<br><br> deltas<br><br> rivers<br><br> sand dunes
    14·2 answers
  • Cellular respiration is the process that converts nutrients into ATP (adenosine triphosphate), a storage molecule that provides
    13·2 answers
  • Plz answer correctly 40 POINTSSS 20 POINTSSS EACHHH
    5·2 answers
  • What are some environmental indicators?
    12·1 answer
  • Water, carbon dioxide, oxygen, and some other substances can pass through the cell wall. _________________________ (true or fals
    5·1 answer
  • What are some things that make monkeys special
    5·1 answer
  • The data below represents the fur length in millimeters for the Canadian Red Fox.
    11·1 answer
  • The light reactions of photosynthesis occur in the __________.
    13·1 answer
  • You’re pretty Without (c)<br><br><br><br><br><br><br> You are du(m)b
    5·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!