1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Nitella [24]
11 months ago
5

What is the type of sequence and the common difference/ratio for question 11

Mathematics
1 answer:
Dahasolnce [82]11 months ago
6 0

Solution:

The numbers are given below as

\lbrace3600,1440,576,230.4,...\rbrace

To figure out the common ratio, we will use the formula below

r=\frac{t_2}{t_1}=\frac{t_3}{t_2}=\frac{t_4}{t_3}

By substituting the values, we will have

\begin{gathered} r=\frac{1440}{3600}=\frac{576}{1440}=\frac{230.4}{576} \\ r=\frac{2}{5} \end{gathered}

Hence,

The final answer is

The type of sequence is GEOMETRIC

The common ratio is 2/5

You might be interested in
Solve the equation using the distributive property and properties ofequally 1/2 (x+6)=18 what is the value of X
Natali [406]

x = 30

The distributive property says that we need to multiply what's in the brackets by 1/2 (so 1/2*x and 1/2*6) to get the equation 1/2x + 3 = 18.

Then we need to subtract our constant, 3, from boths sides to get 1/2x = 15.

Multiply both sides by two to isolate x and you get x = 30.

Hope this helps! :)

7 0
3 years ago
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
2 years ago
Read 2 more answers
Construct an equilateral triangle of side 7cm and construct circumcircle.
zalisa [80]

Answer:

To do this, all you need is to draw triangle with each side being 7 cm, and a circle that intersects all three of its corners.

Step-by-step explanation:

  1. With a ruler and a pencil, draw a 7cm line.
  2. With a compass set to a radius of 7cm draw an arc centered around the right end of the line.
  3. With the same compass, still at 7cm, draw an arc centered around the left end of the line.
  4. These two arcs will intersect on either side of the line (you only need one side, so you only need a small arc in the right place, roughly where you think the third point if the triangle is.
  5. Where those arcs intersect is the third point on your triangle.  Mark that, and then trace two lines from that point to either end of the line segment you started with.

<em>You now have an equilateral triangle with 7cm sides.  Next you need to draw the circle</em>

  1. Measure the halfway point on two of your three lines.
  2. Draw a line from that each of those halfway points to the opposite corner. The new lines you're drawing will be perpendicular to the edge your measuring against.
  3. You have now drawn two line segments, and they intersect in the center of the circle.  Now take your compass and set its radius to the distance from that center point to one of the three corner points.
  4. Centered on that middle point, trace a circle with the selected radius.

And you're done!

6 0
2 years ago
A worker is handling the four of a rectangle room that is 12 feet by 15 feet.The tiles are square with side lengths 1 1/3 feet.
Anon25 [30]

Answer:

Step-by-step explanation:

The measure of the floor of the rectangular room that is 12 feet by 15 feet. The formula for determining the area of a rectangle is expressed as

Area = length × width

Area of the rectangular room would be

12 × 15 = 180 feet²

The tiles are square with side lengths 1 1/3 feet. Converting 1 1/3 feet to improper fraction, it becomes 4/3 feet

Area if each tile is

4/3 × 4/3 = 16/9 ft²

The number of tiles needed to cover the entire floor is

180/(16/9) = 180 × 9/16

= 101.25

102 tiles would be needed because the tiles must be whole numbers.

3 0
2 years ago
Question 4 This question has two parts. First, answer Part A. Then, answer Part B. Part A Fill in the blank question. COLLEGE LI
Annette [7]

The equation that models the number of students who live in apartments will be 6n + 15

<h3>How to illustrate the equation?</h3>

Total number of students T = 17n + 23

Students who live in dorm rooms on campus D = 11n + 8.

Therefore, the students who live in apartments will be:

= 17n + 23 - (11n + 8)

= 6n + 15

In order to predict the number of students who will live on campus in 2020, we will need the students that do not share dorm rooms.

Learn more about equations on:

brainly.com/question/2972832

#SPJ1

7 0
2 years ago
Other questions:
  • What does h(40) = 1400 mean in terms of the problem
    10·2 answers
  • How do the signs of the coordinates relate
    12·2 answers
  • What is 7% of 39? <br><br><br> Thank you for your help.
    8·2 answers
  • Add. write your answer as a fraction in simplistic form<br><br> -4 5/9 + 8/9
    15·1 answer
  • A. 110<br><br> B. 90<br><br> C. 135<br><br> D. 45
    15·1 answer
  • Please help me fill this in
    10·1 answer
  • D) y= x - 3/2 <br><br><br><br> HELP ME PLS
    9·2 answers
  • -1/3 - 2/3 I’m sooooo confused
    7·1 answer
  • Mario sells insurance. His goal is to sell 3 types of insurance to each family on a block. He also wants to sell more than 27 po
    6·1 answer
  • Help on this one plsssssss its 54 more secs
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!